BP | GO:0006207 | 'de novo' pyrimidine nucleobase biosynthetic process | IEP | Enrichment |
BP | GO:0006351 | transcription, DNA-templated | IEP | Enrichment |
BP | GO:0006396 | RNA processing | IEP | Enrichment |
BP | GO:0006401 | RNA catabolic process | IEP | Enrichment |
BP | GO:0006402 | mRNA catabolic process | IEP | Enrichment |
BP | GO:0006419 | alanyl-tRNA aminoacylation | IEP | Enrichment |
BP | GO:0006420 | arginyl-tRNA aminoacylation | IEP | Enrichment |
BP | GO:0006438 | valyl-tRNA aminoacylation | IEP | Enrichment |
BP | GO:0006605 | protein targeting | IEP | Enrichment |
BP | GO:0006612 | protein targeting to membrane | IEP | Enrichment |
BP | GO:0006613 | cotranslational protein targeting to membrane | IEP | Enrichment |
BP | GO:0006614 | SRP-dependent cotranslational protein targeting to membrane | IEP | Enrichment |
BP | GO:0006886 | intracellular protein transport | IEP | Enrichment |
MF | GO:0008094 | ATPase, acting on DNA | IEP | Enrichment |
BP | GO:0008104 | protein localization | IEP | Enrichment |
MF | GO:0008134 | transcription factor binding | IEP | Enrichment |
MF | GO:0008168 | methyltransferase activity | IEP | Enrichment |
MF | GO:0008237 | metallopeptidase activity | IEP | Enrichment |
MF | GO:0008312 | 7S RNA binding | IEP | Enrichment |
BP | GO:0009112 | nucleobase metabolic process | IEP | Enrichment |
BP | GO:0009451 | RNA modification | IEP | Enrichment |
BP | GO:0010629 | negative regulation of gene expression | IEP | Enrichment |
BP | GO:0015031 | protein transport | IEP | Enrichment |
MF | GO:0016462 | pyrophosphatase activity | IEP | Enrichment |
MF | GO:0016741 | transferase activity, transferring one-carbon groups | IEP | Enrichment |
MF | GO:0016779 | nucleotidyltransferase activity | IEP | Enrichment |
MF | GO:0016817 | hydrolase activity, acting on acid anhydrides | IEP | Enrichment |
MF | GO:0016818 | hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides | IEP | Enrichment |
MF | GO:0016887 | ATPase | IEP | Enrichment |
MF | GO:0017111 | nucleoside-triphosphatase activity | IEP | Enrichment |
BP | GO:0018130 | heterocycle biosynthetic process | IEP | Enrichment |
MF | GO:0019001 | guanyl nucleotide binding | IEP | Enrichment |
BP | GO:0019856 | pyrimidine nucleobase biosynthetic process | IEP | Enrichment |
CC | GO:0019867 | outer membrane | IEP | Enrichment |
MF | GO:0031369 | translation initiation factor binding | IEP | Enrichment |
MF | GO:0032561 | guanyl ribonucleotide binding | IEP | Enrichment |
BP | GO:0032774 | RNA biosynthetic process | IEP | Enrichment |
BP | GO:0033036 | macromolecule localization | IEP | Enrichment |
CC | GO:0033588 | elongator holoenzyme complex | IEP | Enrichment |
MF | GO:0034062 | 5'-3' RNA polymerase activity | IEP | Enrichment |
BP | GO:0034654 | nucleobase-containing compound biosynthetic process | IEP | Enrichment |
BP | GO:0045047 | protein targeting to ER | MARTKQTARKSTGGKAPRKQLATKAARKTPATGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSQAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA*